PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn104391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 224aa    MW: 25571.6 Da    PI: 7.0798
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn104391genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171055148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+ T++Ed+l+v+ +++lG++ W++Ia +++ gRt++++k++w+++l
       Achn104391 10 RGNITPDEDDLIVKMHALLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 55
                     7999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-25159IPR009057Homeodomain-like
SuperFamilySSF466894.34E-16164IPR009057Homeodomain-like
PROSITE profilePS5129427.069559IPR017930Myb domain
SMARTSM007172.7E-16957IPR001005SANT/Myb domain
PfamPF002492.0E-151055IPR001005SANT/Myb domain
CDDcd001672.10E-121455No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MNYLRPDIKR GNITPDEDDL IVKMHALLGN RWSLIAGRLP GRTDNEIKNY WNTHLSKKLR  60
SQGTDPNTHK KLSDPHVQEP KKRKNSNKKK KNNPKPQPQE EPEKLKVHNP KPIRIKPLGS  120
FSMSRNSSFD WTPTTTTTTT TTTASGTEVA DDPWSNFRYN EVGFLIGDDQ DHDMINCSDL  180
ECHSGVPTSN HTLEKLYEEY LQLLKTEDHD HVELDSFAES LLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-1425951108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051504.11e-91Myb domain protein 7, putative
TrEMBLA0A061DUF41e-91A0A061DUF4_THECC; Myb domain protein 7, putative
STRINGVIT_15s0046g00170.t011e-78(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.12e-36myb domain protein 3